PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 87aa    MW: 10031.7 Da    PI: 10.8022
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037039genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.8e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krie+ks rqv+fskRr+g++KKA E+S+LCda+ a+++fss+gklye+ss
  Lus10037039  9 KRIEDKSSRQVSFSKRRKGLMKKAREISILCDAQLALLVFSSHGKLYEFSS 59
                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.81E-28161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-36160IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MGRRKMELKR IEDKSSRQVS FSKRRKGLMK KAREISILCD AQLALLVFSS HGKLYEFSSH  60
HSRCPLFHSV HIFEFVNVGS CTEFRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-18259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-18259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-18259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D4e-18259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P4e-18159159Myocyte-specific enhancer factor 2B
1tqe_Q4e-18159159Myocyte-specific enhancer factor 2B
1tqe_R4e-18159159Myocyte-specific enhancer factor 2B
1tqe_S4e-18159159Myocyte-specific enhancer factor 2B
3mu6_A2e-18259158Myocyte-specific enhancer factor 2A
3mu6_B2e-18259158Myocyte-specific enhancer factor 2A
3mu6_C2e-18259158Myocyte-specific enhancer factor 2A
3mu6_D2e-18259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795052.15e-27PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
RefseqXP_009795053.12e-27PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
RefseqXP_016435771.15e-27PREDICTED: agamous-like MADS-box protein AGL27 isoform X1
RefseqXP_016435773.12e-27PREDICTED: agamous-like MADS-box protein AGL27 isoform X2
SwissprotQ9S7Q72e-25FLC_ARATH; MADS-box protein FLOWERING LOCUS C
SwissprotA2YNI22e-25MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T42e-25MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLF1T1195e-27F1T119_9ERIC; MADS-box transcription factor
STRINGPOPTR_0003s16870.13e-25(Populus trichocarpa)
STRINGPOPTR_0003s16840.13e-25(Populus trichocarpa)
STRINGPOPTR_0001s13660.14e-25(Populus trichocarpa)
STRINGGLYMA05G28130.18e-25(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.29e-27MIKC_MADS family protein